POLR2F (NM_021974) Human Mass Spec Standard
CAT#: PH300855
POLR2F MS Standard C13 and N15-labeled recombinant protein (NP_068809)
View other "POLR2F" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | POLR2F MS Standard C13 and N15-labeled recombinant protein (NP_068809) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200855 |
Predicted MW | 14.5 kDa |
Protein Sequence |
>RC200855 protein sequence
Red=Cloning site Green=Tags(s) MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRA LQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_068809 |
RefSeq Size | 2109 |
RefSeq ORF | 381 |
Synonyms | HRBP14.4; POLRF; RPABC2; RPABC14.4; RPB6; RPB14.4; RPC15 |
Locus ID | 5435 |
Cytogenetics | 22q13.1 |
Summary | This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411849 | POLR2F HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411849 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide F (POLR2F) |
CNY 3080.00 |
|
TP300855 | Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide F (POLR2F), 20 µg |
CNY 2900.00 |