DCUN1D5 (NM_032299) Human Mass Spec Standard
CAT#: PH300870
DCUN1D5 MS Standard C13 and N15-labeled recombinant protein (NP_115675)
View other "DCUN1D5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | DCUN1D5 MS Standard C13 and N15-labeled recombinant protein (NP_115675) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200870 |
| Predicted MW | 27.5 kDa |
| Protein Sequence |
>RC200870 protein sequence
Red=Cloning site Green=Tags(s) MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGM EKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKN IYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD LSNYDEDGAWPVLLDEFVEWQKVRQTS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115675 |
| RefSeq Size | 12732 |
| RefSeq ORF | 711 |
| Synonyms | SCCRO5 |
| Locus ID | 84259 |
| Cytogenetics | 11q22.3 |
| Summary | Contributes to the neddylation of all cullins by transfering NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which is necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs) (PubMed:26906416, PubMed:23201271, PubMed:19617556). May play a role in DNA damage response and may participate to cell proliferation and anchorage-independent cell growth (PubMed:23098533, PubMed:24192928).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410241 | DCUN1D5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410241 | Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5) |
CNY 3080.00 |
|
| TP300870 | Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5), 20 µg |
CNY 2900.00 |
其它DCUN1D5产品
