NMNAT2 (NM_170706) Human Mass Spec Standard
CAT#: PH300889
NMNAT2 MS Standard C13 and N15-labeled recombinant protein (NP_733820)
View other "NMNAT2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NMNAT2 MS Standard C13 and N15-labeled recombinant protein (NP_733820) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200889 |
Predicted MW | 34 kDa |
Protein Sequence |
>RC200889 protein sequence
Red=Cloning site Green=Tags(s) MEIQELEEIQACQGLWEVFVTLSERARDYLHKTGRFIVIGGIVSPVHDSYGKQGLVSSRHRLIMCQLAVQ NSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTPSMTPVIGQPQNETPQPIYQNSNVAT KPTAAKILGKVGESLSRICCVRPPVERFTFVDENANLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNE ADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVV DYLSQPVIDYILKSQLYINASG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_733820 |
RefSeq Size | 5467 |
RefSeq ORF | 906 |
Synonyms | C1orf15; PNAT2 |
Locus ID | 23057 |
Cytogenetics | 1q25.3 |
Summary | This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus, and is ubiquitously expressed; this enzyme is cytoplasmic, and is predominantly expressed in the brain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406885 | NMNAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414841 | NMNAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406885 | Transient overexpression lysate of nicotinamide nucleotide adenylyltransferase 2 (NMNAT2), transcript variant 2 |
CNY 3080.00 |
|
LY414841 | Transient overexpression lysate of nicotinamide nucleotide adenylyltransferase 2 (NMNAT2), transcript variant 1 |
CNY 3080.00 |
|
TP300889 | Recombinant protein of human nicotinamide nucleotide adenylyltransferase 2 (NMNAT2), transcript variant 2, 20 µg |
CNY 2900.00 |