ABHD6 (NM_020676) Human Mass Spec Standard
CAT#: PH300915
ABHD6 MS Standard C13 and N15-labeled recombinant protein (NP_065727)
View other "ABHD6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ABHD6 MS Standard C13 and N15-labeled recombinant protein (NP_065727) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200915 |
| Predicted MW | 38.3 kDa |
| Protein Sequence |
>RC200915 protein sequence
Red=Cloning site Green=Tags(s) MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGH KPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKK PFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEM SEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQV LDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_065727 |
| RefSeq Size | 2413 |
| RefSeq ORF | 1011 |
| Locus ID | 57406 |
| Cytogenetics | 3p14.3 |
| Summary | Lipase that preferentially hydrolysis medium-chain saturated monoacylglycerols including 2-arachidonoylglycerol (PubMed:22969151). Through 2-arachidonoylglycerol degradation may regulate endocannabinoid signaling pathways (By similarity). Also has a lysophosphatidyl lipase activity with a preference for lysophosphatidylglycerol among other lysophospholipids (By similarity). Also able to degrade bis(monoacylglycero)phosphate (BMP) and constitutes the major enzyme for BMP catabolism (PubMed:26491015). BMP, also known as lysobisphosphatidic acid, is enriched in late endosomes and lysosomes and plays a key role in the formation of intraluminal vesicles and in lipid sorting (PubMed:26491015).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412310 | ABHD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412310 | Transient overexpression lysate of abhydrolase domain containing 6 (ABHD6) |
CNY 3080.00 |
|
| TP300915 | Recombinant protein of human abhydrolase domain containing 6 (ABHD6), 20 µg |
CNY 2900.00 |
