EFHD1 (NM_025202) Human Mass Spec Standard
CAT#: PH300956
EFHD1 MS Standard C13 and N15-labeled recombinant protein (NP_079478)
View other "EFHD1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | EFHD1 MS Standard C13 and N15-labeled recombinant protein (NP_079478) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200956 |
| Predicted MW | 26.9 kDa |
| Protein Sequence |
>RC200956 protein sequence
Red=Cloning site Green=Tags(s) MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAA RPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDE DFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELK AEQDERKREEEERRLRQAAFQKLKANFNT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079478 |
| RefSeq Size | 2000 |
| RefSeq ORF | 717 |
| Synonyms | MST133; MSTP133; PP3051; SWS2 |
| Locus ID | 80303 |
| Cytogenetics | 2q37.1 |
| Summary | This gene encodes a member of the EF-hand super family of calcium binding proteins, which are involved in a variety of cellular processes including mitosis, synaptic transmission, and cytoskeletal rearrangement. The protein encoded by this gene is composed of an N-terminal disordered region, proline-rich elements, two EF-hands, and a C-terminal coiled-coil domain. This protein has been shown to associate with the mitochondrial inner membrane, and in HeLa cells, acts as a novel mitochondrial calcium ion sensor for mitochondrial flash activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403060 | EFHD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403060 | Transient overexpression lysate of EF-hand domain family, member D1 (EFHD1), transcript variant 1 |
CNY 3080.00 |
|
| TP300956 | Recombinant protein of human EF-hand domain family, member D1 (EFHD1), 20 µg |
CNY 2900.00 |
