Zyxin (ZYX) (NM_001010972) Human Mass Spec Standard
CAT#: PH300960
ZYX MS Standard C13 and N15-labeled recombinant protein (NP_001010972)
View other "Zyxin" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ZYX MS Standard C13 and N15-labeled recombinant protein (NP_001010972) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200960 |
| Predicted MW | 61.3 kDa |
| Protein Sequence |
>RC200960 representing NM_001010972
Red=Cloning site Green=Tags(s) MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPED FPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREK VSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLP QVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKF SPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGP LTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQ GQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRP HCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHV LCRKCHTARAQT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001010972 |
| RefSeq Size | 2322 |
| RefSeq ORF | 1716 |
| Synonyms | ESP-2; HED-2 |
| Locus ID | 7791 |
| Cytogenetics | 7q34 |
| Summary | Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles. Alternative splicing results in multiple transcript variants that encode the same isoform. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Focal adhesion |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418663 | ZYX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY418663 | Transient overexpression lysate of zyxin (ZYX), transcript variant 1 |
CNY 4840.00 |
|
| PH314079 | ZYX MS Standard C13 and N15-labeled recombinant protein (NP_003452) |
CNY 19520.00 |
|
| TP300960 | Recombinant protein of human zyxin (ZYX), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP314079 | Recombinant protein of human zyxin (ZYX), transcript variant 1, 20 µg |
CNY 2900.00 |
