HTF9C (TRMT2A) (NM_182984) Human Mass Spec Standard
CAT#: PH300966
TRMT2A MS Standard C13 and N15-labeled recombinant protein (NP_892029)
View other "HTF9C" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
| Product Data | |
| Description | TRMT2A MS Standard C13 and N15-labeled recombinant protein (NP_892029) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200966 |
| Predicted MW | 68.7 kDa |
| Protein Sequence |
>RC200966 protein sequence
Red=Cloning site Green=Tags(s) MSENLDNEGPKPMESCGQESSSALSCPTVSVPPAAPAALEEVEKEGAGAATGPGPQPGLYSYIRDDLFTS EIFKLELQNVPRHASFSDVRRFLGRFGLQPHKTKLFGQPPCAFVTFRSAAERDKALRVLHGALWKGRPLS VRLARPKADPMARRRRQEGESEPPVTRVADVVTPLWTVPYAEQLERKQLECEQVLQKLAKEIGSTNRALL PWLLEQRHKHNKACCPLEGVRPSPQQTEYRNKCEFLVGVGVDGEDNTVGCRLGKYKGGTCAVAAPFDTVH IPEATKQVVKAFQEFIRSTPYSAYDPETYTGHWKQLTVRTSRRHQAMAIAYFHPQKLSPEELAELKTSLA QHFTAGPGRASGVTCLYFVEEGQRKTPSQEGLPLEHVAGDRCIHEDLLGLTFRISPHAFFQVNTPAAEVL YTVIQDWAQLDAGSMVLDVCCGTGTIGLALARKVKRVIGVELCPEAVEDARVNAQDNELSNVEFHCGRAE DLVPTLVSRLASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKG IPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_892029 |
| RefSeq Size | 2857 |
| RefSeq ORF | 1875 |
| Synonyms | HTF9C |
| Locus ID | 27037 |
| Cytogenetics | 22q11.21 |
| Summary | The protein encoded by this gene is of unknown function. However, it is orthologous to the mouse Trmt2a gene and contains an RNA methyltransferase domain. Expression of this gene varies during the cell cycle, with aberrant expression being a possible biomarker in certain breast cancers. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Apr 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405298 | TRMT2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC411594 | TRMT2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY405298 | Transient overexpression lysate of TRM2 tRNA methyltransferase 2 homolog A (S. cerevisiae) (TRMT2A), transcript variant 2 |
CNY 3080.00 |
|
| LY411594 | Transient overexpression lysate of TRM2 tRNA methyltransferase 2 homolog A (S. cerevisiae) (TRMT2A), transcript variant 1 |
CNY 4840.00 |
|
| PH321181 | TRMT2A MS Standard C13 and N15-labeled recombinant protein (NP_073564) |
CNY 19520.00 |
|
| TP300966 | Recombinant protein of human TRM2 tRNA methyltransferase 2 homolog A (S. cerevisiae) (TRMT2A), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP321181 | Recombinant protein of human TRM2 tRNA methyltransferase 2 homolog A (S. cerevisiae) (TRMT2A), transcript variant 1, 20 µg |
CNY 2900.00 |
