PDXK (NM_003681) Human Mass Spec Standard
CAT#: PH300975
PDXK MS Standard C13 and N15-labeled recombinant protein (NP_003672)
View other "PDXK" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PDXK MS Standard C13 and N15-labeled recombinant protein (NP_003672) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200975 |
| Predicted MW | 35.1 kDa |
| Protein Sequence |
>RC200975 protein sequence
Red=Cloning site Green=Tags(s) MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLR LNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKV VPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNP AGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGE GVRPSPMQLELRMVQSKRDIEDPEIVVQATVL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003672 |
| RefSeq Size | 7390 |
| RefSeq ORF | 936 |
| Synonyms | C21orf97; C21orf124; HEL-S-1a; HMSN6C; PKH; PNK; PRED79 |
| Locus ID | 8566 |
| Cytogenetics | 21q22.3 |
| Summary | The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Vitamin B6 metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418499 | PDXK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418499 | Transient overexpression lysate of pyridoxal (pyridoxine, vitamin B6) kinase (PDXK) |
CNY 3080.00 |
|
| TP300975 | Recombinant protein of human pyridoxal (pyridoxine, vitamin B6) kinase (PDXK), 20 µg |
CNY 2900.00 |
