GDAP1L1 (NM_024034) Human Mass Spec Standard
CAT#: PH300976
GDAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_076939)
View other "GDAP1L1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | GDAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_076939) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200976 |
| Predicted MW | 42 kDa |
| Protein Sequence |
>RC200976 protein sequence
Red=Cloning site Green=Tags(s) MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQKVRLVIAEKGL VCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEVGSLQHA RVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLMKLDHEEEPQLSEPYLSK QKKLMAKILEHDDVSYLKKILGELAMVLDQIEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRL KFLGLSKKYWEDGSRPNLQSFFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGS LGGMGYFAYWYLKKKYI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_076939 |
| RefSeq Size | 2798 |
| RefSeq ORF | 1101 |
| Synonyms | dJ881L22.1; dJ995J12.1.1 |
| Locus ID | 78997 |
| Cytogenetics | 20q13.12 |
| Summary | The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1). A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. The protein encoded by this gene is similar in sequence to the human GDAP1 protein. Several transcript variants encoding different isoforms, as well as a noncoding transcript variant, have been found for this gene. [provided by RefSeq, Feb 2012] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411411 | GDAP1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411411 | Transient overexpression lysate of ganglioside-induced differentiation-associated protein 1-like 1 (GDAP1L1) |
CNY 3080.00 |
|
| TP300976 | Recombinant protein of human ganglioside-induced differentiation-associated protein 1-like 1 (GDAP1L1), 20 µg |
CNY 2900.00 |
其它GDAP1L1产品
