COPZ1 (NM_016057) Human Mass Spec Standard
CAT#: PH301023
COPZ1 MS Standard C13 and N15-labeled recombinant protein (NP_057141)
View other "COPZ1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | COPZ1 MS Standard C13 and N15-labeled recombinant protein (NP_057141) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201023 |
| Predicted MW | 20.2 kDa |
| Protein Sequence |
>RC201023 protein sequence
Red=Cloning site Green=Tags(s) MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYK SSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQ QVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057141 |
| RefSeq Size | 1954 |
| RefSeq ORF | 531 |
| Synonyms | CGI-120; COPZ; HSPC181; zeta-COP; zeta1-COP |
| Locus ID | 22818 |
| Cytogenetics | 12q13.13 |
| Summary | This gene encodes a subunit of the cytoplasmic coatamer protein complex, which is involved in autophagy and intracellular protein trafficking. The coatomer protein complex is comprised of seven subunits and functions as the coat protein of coat protein complex (COP)I-vesicles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414222 | COPZ1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414222 | Transient overexpression lysate of coatomer protein complex, subunit zeta 1 (COPZ1) |
CNY 3080.00 |
|
| TP301023 | Recombinant protein of human coatomer protein complex, subunit zeta 1 (COPZ1), 20 µg |
CNY 2900.00 |
