CBR3 (NM_001236) Human Mass Spec Standard
CAT#: PH301073
CBR3 MS Standard C13 and N15-labeled recombinant protein (NP_001227)
View other "CBR3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CBR3 MS Standard C13 and N15-labeled recombinant protein (NP_001227) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201073 |
| Predicted MW | 30.9 kDa |
| Protein Sequence |
>RC201073 protein sequence
Red=Cloning site Green=Tags(s) MSSCSRVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAEGLSPRFHQLDIDDLQSI RALRDFLRKEYGGLNVLVNNAAVAFKSDDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISS LQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHEREGWPNSPYGVSKLGVTVLSRILAR RLDEKRKADRILVNACCPGPVKTDMDGKDSIRTVEEGAETPVYLALLPPDATEPQGQLVHDKVVQNW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001227 |
| RefSeq Size | 1128 |
| RefSeq ORF | 831 |
| Synonyms | hCBR3; HEL-S-25; SDR21C2 |
| Locus ID | 874 |
| Cytogenetics | 21q22.12 |
| Summary | Carbonyl reductase 3 catalyzes the reduction of a large number of biologically and pharmacologically active carbonyl compounds to their corresponding alcohols. The enzyme is classified as a monomeric NADPH-dependent oxidoreductase. CBR3 contains three exons spanning 11.2 kilobases and is closely linked to another carbonyl reductase gene - CBR1. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Arachidonic acid metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420049 | CBR3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420049 | Transient overexpression lysate of carbonyl reductase 3 (CBR3) |
CNY 3080.00 |
|
| TP301073 | Recombinant protein of human carbonyl reductase 3 (CBR3), 20 µg |
CNY 2900.00 |
