MNK1 (MKNK1) (NM_003684) Human Mass Spec Standard
CAT#: PH301149
MKNK1 MS Standard C13 and N15-labeled recombinant protein (NP_003675)
View other "MNK1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MKNK1 MS Standard C13 and N15-labeled recombinant protein (NP_003675) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201149 |
Predicted MW | 51.3 kDa |
Protein Sequence |
>RC201149 protein sequence
Red=Cloning site Green=Tags(s) MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQ NGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQK HFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHR DLKPENILCESPEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDK RCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDL ISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003675 |
RefSeq Size | 2827 |
RefSeq ORF | 1395 |
Synonyms | MNK1 |
Locus ID | 8569 |
Cytogenetics | 1p33 |
Summary | This gene encodes a Ser/Thr protein kinase that interacts with, and is activated by ERK1 and p38 mitogen-activated protein kinases, and thus may play a role in the response to environmental stress and cytokines. This kinase may also regulate transcription by phosphorylating eIF4E via interaction with the C-terminal region of eIF4G. Alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Insulin signaling pathway, MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404698 | MKNK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418502 | MKNK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427613 | MKNK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404698 | Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2 |
CNY 3080.00 |
|
LY418502 | Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1 |
CNY 3080.00 |
|
LY427613 | Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3 |
CNY 3080.00 |
|
TP301149 | Recombinant protein of human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, 20 µg |
CNY 2900.00 |