FVT1 (KDSR) (NM_002035) Human Mass Spec Standard
CAT#: PH301153
KDSR MS Standard C13 and N15-labeled recombinant protein (NP_002026)
View other "FVT1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | KDSR MS Standard C13 and N15-labeled recombinant protein (NP_002026) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201153 |
| Predicted MW | 36.2 kDa |
| Protein Sequence |
>RC201153 protein sequence
Red=Cloning site Green=Tags(s) MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLL QAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFER LMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVY ITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCG MAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002026 |
| RefSeq Size | 5198 |
| RefSeq ORF | 996 |
| Synonyms | DHSR; EKVP4; FVT1; SDR35C1 |
| Locus ID | 2531 |
| Cytogenetics | 18q21.33 |
| Summary | The protein encoded by this gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Metabolic pathways, Sphingolipid metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419576 | KDSR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419576 | Transient overexpression lysate of 3-ketodihydrosphingosine reductase (KDSR) |
CNY 3080.00 |
|
| TP301153 | Recombinant protein of human 3-ketodihydrosphingosine reductase (KDSR), 20 µg |
CNY 2900.00 |
