VTI1B (NM_006370) Human Mass Spec Standard
CAT#: PH301172
VTI1B MS Standard C13 and N15-labeled recombinant protein (NP_006361)
View other "VTI1B" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | VTI1B MS Standard C13 and N15-labeled recombinant protein (NP_006361) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201172 |
| Predicted MW | 26.7 kDa |
| Protein Sequence |
>RC201172 protein sequence
Red=Cloning site Green=Tags(s) MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAP LSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLN RATQSIERSHRIATETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLS IIILLELAILGGLVYYKFFRSH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006361 |
| RefSeq Size | 1357 |
| RefSeq ORF | 696 |
| Synonyms | v-SNARE; VTI1; VTI1-LIKE; vti1-rp1; VTI1L; VTI2 |
| Locus ID | 10490 |
| Cytogenetics | 14q24.1 |
| Summary | V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. May be concerned with increased secretion of cytokines associated with cellular senescence.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | SNARE interactions in vesicular transport |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416689 | VTI1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416689 | Transient overexpression lysate of vesicle transport through interaction with t-SNAREs homolog 1B (yeast) (VTI1B) |
CNY 3080.00 |
|
| TP301172 | Recombinant protein of human vesicle transport through interaction with t-SNAREs homolog 1B (yeast) (VTI1B), 20 µg |
CNY 2900.00 |
