Antizyme inhibitor 1 (AZIN1) (NM_148174) Human Mass Spec Standard
CAT#: PH301198
AZIN1 MS Standard C13 and N15-labeled recombinant protein (NP_680479)
View other "Antizyme inhibitor 1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | AZIN1 MS Standard C13 and N15-labeled recombinant protein (NP_680479) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201198 |
| Predicted MW | 49.5 kDa |
| Protein Sequence |
>RC201198 protein sequence
Red=Cloning site Green=Tags(s) MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVAQIKPFYTVKC NSAPAVLEILAALGTGFACSSKNEMALVQELGVPPENIIYISPCKQVSQIKYAAKVGVNILTCDNEIELK KIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYVH ALSDARCVFDMAGEIGFTMNMLDIGGGFTGTEFQLEEVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSA FTLAVNIIAKKVVENDKFPSGVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFT SSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGI TSDSMMKNFFFVPSCIQLSQEDSFSAEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_680479 |
| RefSeq Size | 4239 |
| RefSeq ORF | 1344 |
| Synonyms | AZI; AZI1; AZIA1; OAZI; OAZIN; ODC1L |
| Locus ID | 51582 |
| Cytogenetics | 8q22.3 |
| Summary | The protein encoded by this gene belongs to the antizyme inhibitor family, which plays a role in cell growth and proliferation by maintaining polyamine homeostasis within the cell. Antizyme inhibitors are homologs of ornithine decarboxylase (ODC, the key enzyme in polyamine biosynthesis) that have lost the ability to decarboxylase ornithine; however, retain the ability to bind to antizymes. Antizymes negatively regulate intracellular polyamine levels by binding to ODC and targeting it for degradation, as well as by inhibiting polyamine uptake. Antizyme inhibitors function as positive regulators of polyamine levels by sequestering antizymes and neutralizing their effect. This gene encodes antizyme inhibitor 1, the first member of this gene family that is ubiquitously expressed, and is localized in the nucleus and cytoplasm. Overexpression of antizyme inhibitor 1 gene has been associated with increased proliferation, cellular transformation and tumorigenesis. Gene knockout studies showed that homozygous mutant mice lacking functional antizyme inhibitor 1 gene died at birth with abnormal liver morphology. RNA editing of this gene, predominantly in the liver tissue, has been linked to the progression of hepatocellular carcinoma. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Sep 2014] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402474 | AZIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407771 | AZIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402474 | Transient overexpression lysate of antizyme inhibitor 1 (AZIN1), transcript variant 1 |
CNY 3080.00 |
|
| LY407771 | Transient overexpression lysate of antizyme inhibitor 1 (AZIN1), transcript variant 2 |
CNY 3080.00 |
|
| TP301198 | Recombinant protein of human antizyme inhibitor 1 (AZIN1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP710283 | Purified recombinant protein of Human antizyme inhibitor 1 (AZIN1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
|
| TP762064 | Purified recombinant protein of Human antizyme inhibitor 1 (AZIN1), transcript variant 1,Phe260-End, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2050.00 |
|
| TP762540 | Purified recombinant protein of Human antizyme inhibitor 1 (AZIN1), transcript variant 1, 50ug |
CNY 2480.00 |
其它Antizyme inhibitor 1产品
