PLAUR (NM_002659) Human Mass Spec Standard
CAT#: PH301222
PLAUR MS Standard C13 and N15-labeled recombinant protein (NP_002650)
View other "PLAUR" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PLAUR MS Standard C13 and N15-labeled recombinant protein (NP_002650) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201222 |
Predicted MW | 37 kDa |
Protein Sequence |
>RC201222 protein sequence
Red=Cloning site Green=Tags(s) MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHS EKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSP EEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLP QNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSM NHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002650 |
RefSeq Size | 1570 |
RefSeq ORF | 1005 |
Synonyms | CD87; U-PAR; UPAR; URKR |
Locus ID | 5329 |
Cytogenetics | 19q13.31 |
Summary | This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400943 | PLAUR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423709 | PLAUR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423710 | PLAUR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400943 | Transient overexpression lysate of plasminogen activator, urokinase receptor (PLAUR), transcript variant 1 |
CNY 3080.00 |
|
LY423709 | Transient overexpression lysate of plasminogen activator, urokinase receptor (PLAUR), transcript variant 2 |
CNY 3080.00 |
|
LY423710 | Transient overexpression lysate of plasminogen activator, urokinase receptor (PLAUR), transcript variant 3 |
CNY 3080.00 |
|
PH317929 | PLAUR MS Standard C13 and N15-labeled recombinant protein (NP_001005376) |
CNY 14250.00 |
|
TP301222 | Recombinant protein of human plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP317929 | Purified recombinant protein of Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP720329 | Recombinant protein of human plasminogen activator, urokinase receptor (PLAUR), transcript variant 2 |
CNY 3140.00 |