NCF1 (NM_000265) Human Mass Spec Standard
CAT#: PH301233
NCF1 MS Standard C13 and N15-labeled recombinant protein (NP_000256)
View other "NCF1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
| Cited in 1 publication. |
Specifications
| Product Data | |
| Description | NCF1 MS Standard C13 and N15-labeled recombinant protein (NP_000256) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201233 |
| Predicted MW | 44.5 kDa |
| Protein Sequence |
>RC201233 representing NM_000265
Red=Cloning site Green=Tags(s) MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENR IIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYL MPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFL EPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYL QKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL EEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000256 |
| RefSeq Size | 1409 |
| RefSeq ORF | 1170 |
| Synonyms | CGD1; NCF1A; NOXO2; p47phox; SH3PXD1A |
| Locus ID | 653361 |
| Cytogenetics | 7q11.23 |
| Summary | The protein encoded by this gene is a 47 kDa cytosolic subunit of neutrophil NADPH oxidase. This oxidase is a multicomponent enzyme that is activated to produce superoxide anion. Mutations in this gene have been associated with chronic granulomatous disease. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Chemokine signaling pathway, Fc gamma R-mediated phagocytosis, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
S-Glutathionylation of p47phox sustains superoxide generation in activated neutrophils.
,null,
Biochimica et biophysica acta. Molecular cell research
,PubMed ID 29195919
[NCF1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400103 | NCF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400103 | Transient overexpression lysate of neutrophil cytosolic factor 1 (NCF1) |
CNY 3080.00 |
|
| TP301233 | Recombinant protein of human neutrophil cytosolic factor 1 (NCF1), 20 µg |
CNY 2900.00 |
|
| TP761217 | Purified recombinant protein of Human neutrophil cytosolic factor 1 (NCF1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |

