FKBP12 (FKBP1A) (NM_000801) Human Mass Spec Standard
CAT#: PH301237
FKBP1A MS Standard C13 and N15-labeled recombinant protein (NP_000792)
View other "FKBP12" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | FKBP1A MS Standard C13 and N15-labeled recombinant protein (NP_000792) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201237 |
Predicted MW | 12 kDa |
Protein Sequence |
>RC201237 protein sequence
Red=Cloning site Green=Tags(s) MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVG QRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000792 |
RefSeq Size | 1643 |
RefSeq ORF | 324 |
Synonyms | FKBP-1A; FKBP-12; FKBP1; FKBP12; PKC12; PKCI2; PPIASE |
Locus ID | 2280 |
Cytogenetics | 20p13 |
Summary | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq, Sep 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400279 | FKBP1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409302 | FKBP1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400279 | Transient overexpression lysate of FK506 binding protein 1A, 12kDa (FKBP1A), transcript variant 12B |
CNY 3080.00 |
|
LY409302 | Transient overexpression lysate of FK506 binding protein 1A, 12kDa (FKBP1A), transcript variant 12A |
CNY 3080.00 |
|
PH300662 | FKBP1A MS Standard C13 and N15-labeled recombinant protein (NP_463460) |
CNY 19520.00 |
|
TP300662 | Recombinant protein of human FK506 binding protein 1A, 12kDa (FKBP1A), transcript variant 12A, 20 µg |
CNY 2900.00 |
|
TP301237 | Recombinant protein of human FK506 binding protein 1A, 12kDa (FKBP1A), transcript variant 12B, 20 µg |
CNY 2900.00 |