p23 (PTGES3) (NM_006601) Human Mass Spec Standard
CAT#: PH301254
PTGES3 MS Standard C13 and N15-labeled recombinant protein (NP_006592)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PTGES3 MS Standard C13 and N15-labeled recombinant protein (NP_006592) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201254 |
| Predicted MW | 18.7 kDa |
| Protein Sequence |
>RC201254 protein sequence
Red=Cloning site Green=Tags(s) MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTD RSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPE VDGADDDSQDSDDEKMPDLE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006592 |
| RefSeq Size | 2045 |
| RefSeq ORF | 480 |
| Synonyms | cPGES; P23; TEBP |
| Locus ID | 10728 |
| Cytogenetics | 12 |
| Summary | This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes. [provided by RefSeq, Feb 2016] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401975 | PTGES3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401975 | Transient overexpression lysate of prostaglandin E synthase 3 (cytosolic) (PTGES3) |
CNY 3080.00 |
|
| TP301254 | Recombinant protein of human prostaglandin E synthase 3 (cytosolic) (PTGES3), 20 µg |
CNY 2900.00 |
