UQCRH (NM_006004) Human Mass Spec Standard
CAT#: PH301258
UQCRH MS Standard C13 and N15-labeled recombinant protein (NP_005995)
View other "UQCRH" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | UQCRH MS Standard C13 and N15-labeled recombinant protein (NP_005995) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201258 |
| Predicted MW | 10.7 kDa |
| Protein Sequence |
>RC201258 protein sequence
Red=Cloning site Green=Tags(s) MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEE LFDFLHARDHCVAHKLFNNLK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005995 |
| RefSeq Size | 623 |
| RefSeq ORF | 273 |
| Synonyms | QCR6; UQCR8 |
| Locus ID | 7388 |
| Cytogenetics | 1p33 |
| Summary | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
| Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416928 | UQCRH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416928 | Transient overexpression lysate of ubiquinol-cytochrome c reductase hinge protein (UQCRH) |
CNY 3080.00 |
|
| TP301258 | Recombinant protein of human ubiquinol-cytochrome c reductase hinge protein (UQCRH), 20 µg |
CNY 2900.00 |
|
| TP721194 | Purified recombinant protein of Human ubiquinol-cytochrome c reductase hinge protein (UQCRH), nuclear gene encoding mitochondrial protein |
CNY 1800.00 |
