M6PR (NM_002355) Human Mass Spec Standard
CAT#: PH301277
M6PR MS Standard C13 and N15-labeled recombinant protein (NP_002346)
View other "M6PR" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | M6PR MS Standard C13 and N15-labeled recombinant protein (NP_002346) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201277 |
| Predicted MW | 31 kDa |
| Protein Sequence |
>RC201277 protein sequence
Red=Cloning site Green=Tags(s) MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSFESTVGQGSDT YIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAV VMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACSPEISHLSVGSILLVTFASLVAVYVVGGFLY QRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002346 |
| RefSeq Size | 2583 |
| RefSeq ORF | 831 |
| Synonyms | CD-M6PR; CD-MPR; MPR-46; MPR 46; MPR46; SMPR |
| Locus ID | 4074 |
| Cytogenetics | 12p13.31 |
| Summary | This gene encodes a member of the P-type lectin family. P-type lectins play a critical role in lysosome function through the specific transport of mannose-6-phosphate-containing acid hydrolases from the Golgi complex to lysosomes. The encoded protein functions as a homodimer and requires divalent cations for ligand binding. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, May 2011] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Lysosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419372 | M6PR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419372 | Transient overexpression lysate of mannose-6-phosphate receptor (cation dependent) (M6PR) |
CNY 3080.00 |
|
| TP301277 | Recombinant protein of human mannose-6-phosphate receptor (cation dependent) (M6PR), 20 µg |
CNY 2900.00 |
