IFT20 (NM_174887) Human Mass Spec Standard
CAT#: PH301337
IFT20 MS Standard C13 and N15-labeled recombinant protein (NP_777547)
View other "IFT20" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | IFT20 MS Standard C13 and N15-labeled recombinant protein (NP_777547) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201337 |
Predicted MW | 16 kDa |
Protein Sequence |
>RC201337 protein sequence
Red=Cloning site Green=Tags(s) MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKM KSLAVSPRLECTGAISAHCKLCLSDSSDSPTSPSRVGGTTGHRCSELAQIYSKAERSSTAATSSPNSRKE NAARKVSG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_777547 |
RefSeq Size | 1006 |
RefSeq ORF | 444 |
Locus ID | 90410 |
Cytogenetics | 17q11.2 |
Summary | This gene encodes a intraflagellar transport protein important for intracellular transport. The encoded protein forms part of a complex involved in trafficking of proteins from the Golgi body, including recycling of immune signalling components (Finetti et al., PubMed: 19855387). This gene is part of a complex set of sense-antisense loci that may be co-regulated. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 14.[provided by RefSeq, Jun 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406292 | IFT20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406292 | Transient overexpression lysate of intraflagellar transport 20 homolog (Chlamydomonas) (IFT20) |
CNY 3080.00 |
|
TP301337 | Recombinant protein of human intraflagellar transport 20 homolog (Chlamydomonas) (IFT20), 20 µg |
CNY 2900.00 |