Calbindin (CALB1) (NM_004929) Human Mass Spec Standard
CAT#: PH301358
CALB1 MS Standard C13 and N15-labeled recombinant protein (NP_004920)
View other "Calbindin" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CALB1 MS Standard C13 and N15-labeled recombinant protein (NP_004920) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201358 |
| Predicted MW | 30 kDa |
| Protein Sequence |
>RC201358 protein sequence
Red=Cloning site Green=Tags(s) MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDD GKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDD TKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENE LDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004920 |
| RefSeq Size | 2531 |
| RefSeq ORF | 783 |
| Synonyms | CALB; D-28K |
| Locus ID | 793 |
| Cytogenetics | 8q21.3 |
| Summary | The protein encoded by this gene is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. Originally described as a 27 kDa protein, it is now known to be a 28 kDa protein. It contains four active calcium-binding domains, and has two modified domains that are thought to have lost their calcium binding capability. This protein is thought to buffer entry of calcium upon stimulation of glutamate receptors. Depletion of this protein was noted in patients with Huntington disease. [provided by RefSeq, Jan 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417646 | CALB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417646 | Transient overexpression lysate of calbindin 1, 28kDa (CALB1) |
CNY 3080.00 |
|
| TP301358 | Recombinant protein of human calbindin 1, 28kDa (CALB1), 20 µg |
CNY 2900.00 |
其它Calbindin产品
