HENMT1 (NM_144584) Human Mass Spec Standard
CAT#: PH301373
C1orf59 MS Standard C13 and N15-labeled recombinant protein (NP_653185)
View other "HENMT1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C1orf59 MS Standard C13 and N15-labeled recombinant protein (NP_653185) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201373 |
Predicted MW | 44.5 kDa |
Protein Sequence |
>RC201373 protein sequence
Red=Cloning site Green=Tags(s) MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPC IELLVGVDINEDKLRWRGDSLAPFLGDFLKPRDLNLTITLYHGSVVERDSRLLGFDLITCIELIEHLDSG DLARFPEVVFGYLSPSMIVISTPNSEFNPLFPSVTLRDSDHKFEWTRMEFQTWALYVANRYDYSVEFTGV GEPPAGAENVGYCTQIGIFRKNGGKATESCLSEQHDQHVYKAVFTTSYPSLQQERFFKLVLVNEVSQQVE SLRVSHLPRRKEQAGERGDKPKDIGGSKAPVPCFGPVFTEVEKAKIENSPTPFCVGDKFFVPLQRLLAYP KLNRLCANEEIMRSVIADSIPLSSDGSAVVADLRNYFDEQFEF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_653185 |
RefSeq Size | 1890 |
RefSeq ORF | 1179 |
Synonyms | C1orf59; HEN1 |
Locus ID | 113802 |
Cytogenetics | 1p13.3 |
Summary | Methyltransferase that adds a 2'-O-methyl group at the 3'-end of piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. This probably protects the 3'-end of piRNAs from uridylation activity and subsequent degradation. Stabilization of piRNAs is essential for gametogenesis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408292 | HENMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420162 | HENMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408292 | Transient overexpression lysate of chromosome 1 open reading frame 59 (C1orf59), transcript variant 1 |
CNY 3080.00 |
|
LY420162 | Transient overexpression lysate of chromosome 1 open reading frame 59 (C1orf59), transcript variant 2 |
CNY 3080.00 |
|
PH312823 | C1orf59 MS Standard C13 and N15-labeled recombinant protein (NP_001096062) |
CNY 14250.00 |
|
TP301373 | Recombinant protein of human chromosome 1 open reading frame 59 (C1orf59), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP312823 | Purified recombinant protein of Homo sapiens chromosome 1 open reading frame 59 (C1orf59), transcript variant 2, 20 µg |
CNY 2900.00 |