NAP1L4 (NM_005969) Human Mass Spec Standard
CAT#: PH301407
NAP1L4 MS Standard C13 and N15-labeled recombinant protein (NP_005960)
View other "NAP1L4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NAP1L4 MS Standard C13 and N15-labeled recombinant protein (NP_005960) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201407 |
| Predicted MW | 42.8 kDa |
| Protein Sequence |
>RC201407 protein sequence
Red=Cloning site Green=Tags(s) MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINAL KQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSK VVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHF EPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTI TKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGE EGEEEELEGDEEGEDEDDAEINPKV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005960 |
| RefSeq Size | 2564 |
| RefSeq ORF | 1125 |
| Synonyms | hNAP2; NAP1L4b; NAP2; NAP2L |
| Locus ID | 4676 |
| Cytogenetics | 11p15.4 |
| Summary | This gene encodes a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416953 | NAP1L4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416953 | Transient overexpression lysate of nucleosome assembly protein 1-like 4 (NAP1L4) |
CNY 3080.00 |
|
| TP301407 | Recombinant protein of human nucleosome assembly protein 1-like 4 (NAP1L4), 20 µg |
CNY 2900.00 |
