C11orf49 (NM_024113) Human Mass Spec Standard
CAT#: PH301435
C11orf49 MS Standard C13 and N15-labeled recombinant protein (NP_077018)
View other "C11orf49" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C11orf49 MS Standard C13 and N15-labeled recombinant protein (NP_077018) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201435 |
Predicted MW | 37.4 kDa |
Protein Sequence |
>RC201435 protein sequence
Red=Cloning site Green=Tags(s) MLSPERLALPDYEYLAQRHVLTYMEDAVCQLLENREDISQYGIARFFTEYFNSVCQGTHILFREFSFVQA TPHNRVSFLRAFWRCFRTVGKNGDLLTMKEYHCLLQLLCPDFPLELTQKAARIVLMDDAMDCLMSFSDFL FAFQIQFYYSEFLDSVAAIYEDLLSGKNPNTVIVPTSSSGQHRQRPALGGAGTLEGVEASLFYQCLENLC DRHKYSCPPPALVKEALSNVQRLTFYGFLMALSKHRGINQALGALPDKGDLMHDPAMDEELERLLAQVPG LVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_077018 |
RefSeq Size | 1746 |
RefSeq ORF | 993 |
Locus ID | 79096 |
Cytogenetics | 11p11.2 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411347 | C11orf49 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424096 | C11orf49 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424097 | C11orf49 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424098 | C11orf49 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411347 | Transient overexpression lysate of chromosome 11 open reading frame 49 (C11orf49), transcript variant 3 |
CNY 3080.00 |
|
LY424096 | Transient overexpression lysate of chromosome 11 open reading frame 49 (C11orf49), transcript variant 1 |
CNY 3080.00 |
|
LY424097 | Transient overexpression lysate of chromosome 11 open reading frame 49 (C11orf49), transcript variant 2 |
CNY 3080.00 |
|
LY424098 | Transient overexpression lysate of chromosome 11 open reading frame 49 (C11orf49), transcript variant 4 |
CNY 3080.00 |
|
TP301435 | Recombinant protein of human chromosome 11 open reading frame 49 (C11orf49), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP760102 | Recombinant protein of human chromosome 11 open reading frame 49 (C11orf49), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
TP761377 | Purified recombinant protein of Human chromosome 11 open reading frame 49 (C11orf49), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它C11orf49产品