SDHAF2 (NM_017841) Human Mass Spec Standard
CAT#: PH301437
SDHAF2 MS Standard C13 and N15-labeled recombinant protein (NP_060311)
View other "SDHAF2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SDHAF2 MS Standard C13 and N15-labeled recombinant protein (NP_060311) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201437 |
| Predicted MW | 19.6 kDa |
| Protein Sequence |
>RC201437 protein sequence
Red=Cloning site Green=Tags(s) MAVSTVFSTSSLMLALSRHSLLSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARL LYESRKRGMLENCILLSLFAKEHLQHMTEKQLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVMALL RDFAKNKNKEQRLRAPDLEYLFEKPR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060311 |
| RefSeq Size | 1227 |
| RefSeq ORF | 498 |
| Synonyms | C11orf79; PGL2; SDH5 |
| Locus ID | 54949 |
| Cytogenetics | 11q12.2 |
| Summary | This gene encodes a mitochondrial protein needed for the flavination of a succinate dehydrogenase complex subunit required for activity of the complex. Mutations in this gene are associated with paraganglioma.[provided by RefSeq, Jul 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402625 | SDHAF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402625 | Transient overexpression lysate of succinate dehydrogenase complex assembly factor 2 (SDHAF2) |
CNY 3080.00 |
|
| TP301437 | Recombinant protein of human chromosome 11 open reading frame 79 (C11orf79), 20 µg |
CNY 2900.00 |
