RILPL2 (NM_145058) Human Mass Spec Standard
CAT#: PH301447
RILPL2 MS Standard C13 and N15-labeled recombinant protein (NP_659495)
View other "RILPL2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RILPL2 MS Standard C13 and N15-labeled recombinant protein (NP_659495) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201447 |
| Predicted MW | 24 kDa |
| Protein Sequence |
>RC201447 protein sequence
Red=Cloning site Green=Tags(s) MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVR VLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRD VLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQ T myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_659495 |
| RefSeq Size | 1435 |
| RefSeq ORF | 633 |
| Synonyms | RLP2 |
| Locus ID | 196383 |
| Cytogenetics | 12q24.31 |
| Summary | This gene encodes a protein that contains a rab-interacting lysosomal protein-like domain. This protein may be involved in regulating lysosome morphology. This protein may also be a target for the Hepatitis C virus and assist in viral replication. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408055 | RILPL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408055 | Transient overexpression lysate of Rab interacting lysosomal protein-like 2 (RILPL2) |
CNY 3080.00 |
|
| TP301447 | Recombinant protein of human Rab interacting lysosomal protein-like 2 (RILPL2), 20 µg |
CNY 2900.00 |
