MOBK1B (MOB1A) (NM_018221) Human Mass Spec Standard
CAT#: PH301487
MOBKL1B MS Standard C13 and N15-labeled recombinant protein (NP_060691)
View other "MOBK1B" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MOBKL1B MS Standard C13 and N15-labeled recombinant protein (NP_060691) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201487 |
Predicted MW | 24.9 kDa |
Protein Sequence |
>RC201487 representing NM_018221
Red=Cloning site Green=Tags(s) MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINM LYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF PKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK LGSKDR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060691 |
RefSeq Size | 2543 |
RefSeq ORF | 648 |
Synonyms | C2orf6; MATS1; MOB1; Mob4B; MOBK1B; MOBKL1B |
Locus ID | 55233 |
Cytogenetics | 2p13.1 |
Summary | The protein encoded by this gene is a component of the Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413201 | MOB1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413201 | Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 1B (yeast) (MOBKL1B) |
CNY 3080.00 |
|
TP301487 | Recombinant protein of human MOB1, Mps One Binder kinase activator-like 1B (yeast) (MOBKL1B), 20 µg |
CNY 2900.00 |
|
TP720267 | Recombinant protein of human MOB1, Mps One Binder kinase activator-like 1B (yeast) (MOBKL1B) |
CNY 1800.00 |