DYNLT3 (NM_006520) Human Mass Spec Standard
CAT#: PH301525
DYNLT3 MS Standard C13 and N15-labeled recombinant protein (NP_006511)
View other "DYNLT3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DYNLT3 MS Standard C13 and N15-labeled recombinant protein (NP_006511) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201525 |
Predicted MW | 13.1 kDa |
Protein Sequence |
>RC201525 protein sequence
Red=Cloning site Green=Tags(s) MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAV VQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006511 |
RefSeq Size | 2230 |
RefSeq ORF | 348 |
Synonyms | RP3; TCTE1L; TCTEX1L |
Locus ID | 6990 |
Cytogenetics | Xp11.4 |
Summary | This gene encodes a member of a subclass of dynein light chains. The encoded protein homodimerizes and forms the light chain component of the cytoplasmic dynein motor protein complex. This protein may be important for binding dynein to specific cargos including the spindle checkpoint protein BUB3. This protein may also function independently of dynein as a transcriptional modulator. Pseudogenes of this gene are found on chromosomes 2 and 20.[provided by RefSeq, Mar 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416586 | DYNLT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416586 | Transient overexpression lysate of dynein, light chain, Tctex-type 3 (DYNLT3) |
CNY 3080.00 |
|
TP301525 | Recombinant protein of human dynein, light chain, Tctex-type 3 (DYNLT3), 20 µg |
CNY 2900.00 |