GAS41 (YEATS4) (NM_006530) Human Mass Spec Standard
CAT#: PH301526
YEATS4 MS Standard C13 and N15-labeled recombinant protein (NP_006521)
View other "GAS41" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | YEATS4 MS Standard C13 and N15-labeled recombinant protein (NP_006521) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201526 |
Predicted MW | 26.5 kDa |
Protein Sequence |
>RC201526 protein sequence
Red=Cloning site Green=Tags(s) MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKL HESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYD EMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINC LKNEIRKLEEDDQAKDI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006521 |
RefSeq Size | 1509 |
RefSeq ORF | 681 |
Synonyms | 4930573H17Rik; B230215M10Rik; GAS41; NUBI-1; YAF9 |
Locus ID | 8089 |
Cytogenetics | 12q15 |
Summary | The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401956 | YEATS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401956 | Transient overexpression lysate of YEATS domain containing 4 (YEATS4) |
CNY 3080.00 |
|
TP301526 | Purified recombinant protein of Homo sapiens YEATS domain containing 4 (YEATS4), 20 µg |
CNY 2900.00 |