S100P (NM_005980) Human Mass Spec Standard
CAT#: PH301533
S100P MS Standard C13 and N15-labeled recombinant protein (NP_005971)
View other "S100P" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | S100P MS Standard C13 and N15-labeled recombinant protein (NP_005971) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201533 |
Predicted MW | 10.4 kDa |
Protein Sequence |
>RC201533 protein sequence
Red=Cloning site Green=Tags(s) MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVD FSEFIVFVAAITSACHKYFEKAGLK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005971 |
RefSeq Size | 510 |
RefSeq ORF | 285 |
Synonyms | MIG9 |
Locus ID | 6286 |
Cytogenetics | 4p16.1 |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401809 | S100P HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401809 | Transient overexpression lysate of S100 calcium binding protein P (S100P) |
CNY 3080.00 |
|
TP301533 | Recombinant protein of human S100 calcium binding protein P (S100P), 20 µg |
CNY 2900.00 |
|
TP720231 | Recombinant protein of human S100 calcium binding protein P (S100P) |
CNY 1800.00 |