L Kynurenine Hydrolase (KYNU) (NM_001032998) Human Mass Spec Standard
CAT#: PH301559
KYNU MS Standard C13 and N15-labeled recombinant protein (NP_001028170)
View other "L Kynurenine Hydrolase" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | KYNU MS Standard C13 and N15-labeled recombinant protein (NP_001028170) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201559 |
| Predicted MW | 34.6 kDa |
| Protein Sequence |
>RC201559 protein sequence
Red=Cloning site Green=Tags(s) MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIY FLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVN LHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEK EGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNA GAGGIAGAFIHEKHAHTIKPARSEFFN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001028170 |
| RefSeq Size | 1315 |
| RefSeq ORF | 921 |
| Synonyms | KYNUU; VCRL2 |
| Locus ID | 8942 |
| Cytogenetics | 2q22.2 |
| Summary | Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010] |
| Protein Families | Protease |
| Protein Pathways | Metabolic pathways, Tryptophan metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418347 | KYNU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422334 | KYNU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429170 | KYNU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418347 | Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 1 |
CNY 4840.00 |
|
| LY422334 | Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2 |
CNY 3080.00 |
|
| TP301559 | Recombinant protein of human kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP762412 | Purified recombinant protein of Human kynureninase (KYNU), transcript variant 1, full length, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
其它L Kynurenine Hydrolase产品
