GALE (NM_000403) Human Mass Spec Standard
CAT＃: PH301561
GALE MS Standard C13 and N15-labeled recombinant protein (NP_000394)
View other "GALE" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
CNY 1999.00
CNY 2700.00
热销推荐Specifications
| Product Data | |
| Description | GALE MS Standard C13 and N15-labeled recombinant protein (NP_000394) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201561 |
| Predicted MW | 38.3 kDa |
| Protein Sequence |
>RC201561 protein sequence
Red=Cloning site Green=Tags(s) MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQ GALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQ YLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMP YVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQM VQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000394 |
| RefSeq Size | 1647 |
| RefSeq ORF | 1044 |
| Synonyms | SDR1E1 |
| Locus ID | 2582 |
| Cytogenetics | 1p36.11 |
| Summary | This gene encodes UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and cognitive disability, with symptoms ranging from mild ('peripheral' form) to severe ('generalized' form). Multiple alternatively spliced transcripts encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423394 | GALE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424739 | GALE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426826 | GALE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423394 | Transient overexpression lysate of UDP-galactose-4-epimerase (GALE), transcript variant 2 |
CNY 3080.00 |
|
| LY424739 | Transient overexpression lysate of UDP-galactose-4-epimerase (GALE), transcript variant 1 |
CNY 3080.00 |
|
| LY426826 | Transient overexpression lysate of UDP-galactose-4-epimerase (GALE), transcript variant 3 |
CNY 3080.00 |
|
| PH308709 | GALE MS Standard C13 and N15-labeled recombinant protein (NP_001008217) |
CNY 19520.00 |
|
| PH325521 | GALE MS Standard C13 and N15-labeled recombinant protein (NP_001121093) |
CNY 19520.00 |
|
| TP301561 | Recombinant protein of human UDP-galactose-4-epimerase (GALE), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP308709 | Recombinant protein of human UDP-galactose-4-epimerase (GALE), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP325521 | Recombinant protein of human UDP-galactose-4-epimerase (GALE), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP720236 | Recombinant protein of human UDP-galactose-4-epimerase (GALE), transcript variant 1 |
CNY 1800.00 |
