Heat Shock Factor 2 Binding Protein (HSF2BP) (NM_007031) Human Mass Spec Standard
CAT#: PH301580
HSF2BP MS Standard C13 and N15-labeled recombinant protein (NP_008962)
View other "Heat Shock Factor 2 Binding Protein" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | HSF2BP MS Standard C13 and N15-labeled recombinant protein (NP_008962) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201580 |
| Predicted MW | 37.6 kDa |
| Protein Sequence |
>RC201580 protein sequence
Red=Cloning site Green=Tags(s) MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQE LEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEV VKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVL LDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQ SVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008962 |
| RefSeq Size | 1916 |
| RefSeq ORF | 1002 |
| Synonyms | MEILB2; POF19 |
| Locus ID | 11077 |
| Cytogenetics | 21q22.3 |
| Summary | HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416250 | HSF2BP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416250 | Transient overexpression lysate of heat shock transcription factor 2 binding protein (HSF2BP) |
CNY 3080.00 |
|
| TP301580 | Recombinant protein of human heat shock transcription factor 2 binding protein (HSF2BP), 20 µg |
CNY 2900.00 |
其它Heat Shock Factor 2 Binding Protein产品
