Lysosomal acid lipase (LIPA) (NM_000235) Human Mass Spec Standard
CAT#: PH301637
LIPA MS Standard C13 and N15-labeled recombinant protein (NP_000226)
View other "Lysosomal acid lipase" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LIPA MS Standard C13 and N15-labeled recombinant protein (NP_000226) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201637 |
| Predicted MW | 45.4 kDa |
| Protein Sequence |
>RC201637 protein sequence
Red=Cloning site Green=Tags(s) MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGR KNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFW AFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCT SPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVY TTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADV YDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000226 |
| RefSeq Size | 2775 |
| RefSeq ORF | 1197 |
| Synonyms | CESD; LAL |
| Locus ID | 3988 |
| Cytogenetics | 10q23.31 |
| Summary | This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014] |
| Protein Families | Druggable Genome |
| Protein Pathways | Lysosome, Steroid biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424848 | LIPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426820 | LIPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424848 | Transient overexpression lysate of lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 2 |
CNY 3080.00 |
|
| LY426820 | Transient overexpression lysate of lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 1 |
CNY 3080.00 |
|
| TP301637 | Recombinant protein of human lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Lysosomal acid lipase产品

