MED10 (NM_032286) Human Mass Spec Standard
CAT#: PH301665
MED10 MS Standard C13 and N15-labeled recombinant protein (NP_115662)
View other "MED10" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MED10 MS Standard C13 and N15-labeled recombinant protein (NP_115662) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201665 |
| Predicted MW | 15.7 kDa |
| Protein Sequence |
>RC201665 protein sequence
Red=Cloning site Green=Tags(s) MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEY IDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115662 |
| RefSeq Size | 1059 |
| RefSeq ORF | 405 |
| Synonyms | L6; NUT2; TRG20 |
| Locus ID | 84246 |
| Cytogenetics | 5p15.31 |
| Summary | MED10 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]).[supplied by OMIM, Oct 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410229 | MED10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410229 | Transient overexpression lysate of mediator complex subunit 10 (MED10) |
CNY 3080.00 |
|
| TP301665 | Recombinant protein of human mediator complex subunit 10 (MED10), 20 µg |
CNY 2900.00 |

