CD63 (NM_001780) Human Mass Spec Standard
CAT#: PH301733
CD63 MS Standard C13 and N15-labeled recombinant protein (NP_001771)
View other "CD63" proteins (3)
| Need it in bulk or customized? Get a free quote | 
CNY 19520.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | CD63 MS Standard C13 and N15-labeled recombinant protein (NP_001771) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC201733 | 
| Predicted MW | 25.6 kDa | 
| Protein Sequence | >RC201733 protein sequence Red=Cloning site Green=Tags(s) MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFV GCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQ ADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAA LGIAFVEVLGIVFACCLVKSIRSGYEVM myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001771 | 
| RefSeq Size | 1032 | 
| RefSeq ORF | 714 | 
| Synonyms | LAMP-3; ME491; MLA1; OMA81H; TSPAN30 | 
| Locus ID | 967 | 
| Cytogenetics | 12q13.2 | 
| Summary | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Apr 2012] | 
| Protein Families | Druggable Genome, Transmembrane | 
| Protein Pathways | Lysosome | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC419757 | CD63 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY419757 | Transient overexpression lysate of CD63 molecule (CD63), transcript variant 1 | CNY 3080.00 | |
| TP301733 | Recombinant protein of human CD63 molecule (CD63), transcript variant 1, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | 

 
                        


 
        