SNRPD2 (NM_004597) Human Mass Spec Standard
CAT#: PH301736
SNRPD2 MS Standard C13 and N15-labeled recombinant protein (NP_004588)
View other "SNRPD2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SNRPD2 MS Standard C13 and N15-labeled recombinant protein (NP_004588) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201736 |
Predicted MW | 13.5 kDa |
Protein Sequence |
>RC201736 protein sequence
Red=Cloning site Green=Tags(s) MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENV KEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004588 |
RefSeq Size | 767 |
RefSeq ORF | 354 |
Synonyms | Sm-D2; SMD2; SNRPD1 |
Locus ID | 6633 |
Cytogenetics | 19q13.32 |
Summary | The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406078 | SNRPD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417879 | SNRPD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406078 | Transient overexpression lysate of small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 2 |
CNY 3080.00 |
|
LY417879 | Transient overexpression lysate of small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 1 |
CNY 3080.00 |
|
TP301736 | Recombinant protein of human small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 1, 20 µg |
CNY 2900.00 |