UBE2N (NM_003348) Human Mass Spec Standard
CAT#: PH301792
UBE2N MS Standard C13 and N15-labeled recombinant protein (NP_003339)
View other "UBE2N" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | UBE2N MS Standard C13 and N15-labeled recombinant protein (NP_003339) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201792 |
| Predicted MW | 17.1 kDa |
| Protein Sequence |
>RC201792 protein sequence
Red=Cloning site Green=Tags(s) MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVR FMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETA RAWTRLYAMNNI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003339 |
| RefSeq Size | 2568 |
| RefSeq ORF | 456 |
| Synonyms | HEL-S-71; UBC13; UbcH-ben; UbcH13; UBCHBEN |
| Locus ID | 7334 |
| Cytogenetics | 12q22 |
| Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Studies in mouse suggest that this protein plays a role in DNA postreplication repair. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418741 | UBE2N HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418741 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) (UBE2N) |
CNY 3080.00 |
|
| TP301792 | Recombinant protein of human ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) (UBE2N), 20 µg |
CNY 2900.00 |
