HNRNPD (NM_031370) Human Mass Spec Standard
CAT#: PH301796
HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_112738)
View other "HNRNPD" proteins (16)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_112738) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201796 |
Predicted MW | 38.3 kDa |
Protein Sequence |
>RC201796 representing NM_031370
Red=Cloning site Green=Tags(s) MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDA SKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGF GFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVES IELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRAR GRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQN SYKPY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112738 |
RefSeq Size | 2257 |
RefSeq ORF | 1065 |
Synonyms | AUF1; AUF1A; hnRNPD0; HNRPD; P37 |
Locus ID | 3184 |
Cytogenetics | 4q21.22 |
Summary | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. This protein is implicated in the regulation of mRNA stability. Alternative splicing of this gene results in four transcript variants. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410547 | HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC410548 | HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419510 | HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424021 | HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410547 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 2 |
CNY 3080.00 |
|
LY410548 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 1 |
CNY 3080.00 |
|
LY419510 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 3 |
CNY 3080.00 |
|
LY424021 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 4 |
CNY 3080.00 |
|
PH300660 | HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_002129) |
CNY 14250.00 |
|
PH320809 | HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_001003810) |
CNY 19520.00 |
|
PH322094 | HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_112737) |
CNY 14250.00 |
|
TP300660 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP301796 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP320809 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 4, 20 µg |
CNY 2900.00 |
|
TP322094 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP760280 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |