HSP27 (HSPB1) (NM_001540) Human Mass Spec Standard
CAT#: PH301800
HSPB1 MS Standard C13 and N15-labeled recombinant protein (NP_001531)
View other "HSP27" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 3600.00
Specifications
Product Data | |
Description | HSPB1 MS Standard C13 and N15-labeled recombinant protein (NP_001531) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201800 |
Predicted MW | 22.8 kDa |
Protein Sequence |
>RC201800 protein sequence
Red=Cloning site Green=Tags(s) MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAA PAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTR KYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001531 |
RefSeq Size | 914 |
RefSeq ORF | 615 |
Synonyms | CMT2F; HEL-S-102; HMN2B; HS.76067; Hsp25; HSP27; HSP28; SRP27 |
Locus ID | 3315 |
Cytogenetics | 7q11.23 |
Summary | This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct folding of other proteins. This protein plays an important role in the differentiation of a wide variety of cell types. Expression of this gene is correlated with poor clinical outcome in multiple human cancers, and the encoded protein may promote cancer cell proliferation and metastasis, while protecting cancer cells from apoptosis. Mutations in this gene have been identified in human patients with Charcot-Marie-Tooth disease and distal hereditary motor neuropathy. [provided by RefSeq, Aug 2017] |
Protein Pathways | MAPK signaling pathway, VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400587 | HSPB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400587 | Transient overexpression lysate of heat shock 27kDa protein 1 (HSPB1) |
CNY 3080.00 |
|
TP301800 | Recombinant protein of human heat shock 27kDa protein 1 (HSPB1), 20 µg |
CNY 2900.00 |