SMAD4 (NM_005359) Human Mass Spec Standard
CAT#: PH301828
SMAD4 MS Standard C13 and N15-labeled recombinant protein (NP_005350)
View other "SMAD4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SMAD4 MS Standard C13 and N15-labeled recombinant protein (NP_005350) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201828 |
| Predicted MW | 60.3 kDa |
| Protein Sequence |
>RC201828 representing NM_005359
Red=Cloning site Green=Tags(s) MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSK CVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPG IDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATS TANFPNIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNL PHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTV DGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGI GVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005350 |
| RefSeq Size | 3220 |
| RefSeq ORF | 1656 |
| Synonyms | DPC4; JIP; MADH4; MYHRS |
| Locus ID | 4089 |
| Cytogenetics | 18q21.2 |
| Summary | This gene encodes a member of the Smad family of signal transduction proteins. Smad proteins are phosphorylated and activated by transmembrane serine-threonine receptor kinases in response to transforming growth factor (TGF)-beta signaling. The product of this gene forms homomeric complexes and heteromeric complexes with other activated Smad proteins, which then accumulate in the nucleus and regulate the transcription of target genes. This protein binds to DNA and recognizes an 8-bp palindromic sequence (GTCTAGAC) called the Smad-binding element (SBE). The protein acts as a tumor suppressor and inhibits epithelial cell proliferation. It may also have an inhibitory effect on tumors by reducing angiogenesis and increasng blood vessel hyperpermeability. The encoded protein is a crucial component of the bone morphogenetic protein signaling pathway. The Smad proteins are subject to complex regulation by post-translational modifications. Mutations or deletions in this gene have been shown to result in pancreatic cancer, juvenile polyposis syndrome, and hereditary hemorrhagic telangiectasia syndrome. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Adherens junction, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Pancreatic cancer, Pathways in cancer, TGF-beta signaling pathway, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401648 | SMAD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401648 | Transient overexpression lysate of SMAD family member 4 (SMAD4) |
CNY 3080.00 |
|
| TP301828 | Recombinant protein of human SMAD family member 4 (SMAD4), 20 µg |
CNY 2900.00 |
|
| TP762318 | Purified recombinant protein of Human SMAD family member 4 (SMAD4), Ala152-Tyr322, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
|
| TP762677 | Purified recombinant protein of Human SMAD family member 4 (SMAD4), 1Met-195Tyr, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 2480.00 |

