PIG3 (TP53I3) (NM_004881) Human Mass Spec Standard
CAT#: PH301839
TP53I3 MS Standard C13 and N15-labeled recombinant protein (NP_004872)
View other "PIG3" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | TP53I3 MS Standard C13 and N15-labeled recombinant protein (NP_004872) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201839 |
| Predicted MW | 35.5 kDa |
| Protein Sequence |
>RC201839 protein sequence
Red=Cloning site Green=Tags(s) MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVA ELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQA GDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGV NLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNA FTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004872 |
| RefSeq Size | 2042 |
| RefSeq ORF | 996 |
| Synonyms | PIG3 |
| Locus ID | 9540 |
| Cytogenetics | 2p23.3 |
| Summary | The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell death. It contains a p53 consensus binding site in its promoter region and a downstream pentanucleotide microsatellite sequence. P53 has been shown to transcriptionally activate this gene by interacting with the downstream pentanucleotide microsatellite sequence. The microsatellite is polymorphic, with a varying number of pentanucleotide repeats directly correlated with the extent of transcriptional activation by p53. It has been suggested that the microsatellite polymorphism may be associated with differential susceptibility to cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | p53 signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407779 | TP53I3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417682 | TP53I3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429226 | TP53I3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407779 | Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2 |
CNY 3080.00 |
|
| LY417682 | Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1 |
CNY 3080.00 |
|
| LY429226 | Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1 |
CNY 3080.00 |
|
| PH324067 | TP53I3 MS Standard C13 and N15-labeled recombinant protein (NP_671713) |
CNY 19520.00 |
|
| TP301839 | Recombinant protein of human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP324067 | Recombinant protein of human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2, 20 µg |
CNY 2900.00 |


