RNF141 (NM_016422) Human Mass Spec Standard
CAT#: PH301861
RNF141 MS Standard C13 and N15-labeled recombinant protein (NP_057506)
View other "RNF141" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | RNF141 MS Standard C13 and N15-labeled recombinant protein (NP_057506) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201861 |
Predicted MW | 25.5 kDa |
Protein Sequence |
>RC201861 protein sequence
Red=Cloning site Green=Tags(s) MGQQISDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDS SAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQAS LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTE DDMANYILNMADEAGQPHRP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057506 |
RefSeq Size | 4084 |
RefSeq ORF | 690 |
Synonyms | RFP141; ZFP26; ZNF230 |
Locus ID | 50862 |
Cytogenetics | 11p15 |
Summary | The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414010 | RNF141 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414010 | Transient overexpression lysate of ring finger protein 141 (RNF141) |
CNY 3080.00 |
|
TP301861 | Recombinant protein of human ring finger protein 141 (RNF141), 20 µg |
CNY 2900.00 |