C20orf30 (TMEM230) (NM_014145) Human Mass Spec Standard
CAT#: PH301878
C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_054864)
View other "C20orf30" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_054864) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201878 |
Predicted MW | 13.2 kDa |
Protein Sequence |
>RC201878 protein sequence
Red=Cloning site Green=Tags(s) MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGY ISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054864 |
RefSeq Size | 1699 |
RefSeq ORF | 360 |
Synonyms | C20orf30; dJ1116H23.2.1; HSPC274 |
Locus ID | 29058 |
Cytogenetics | 20p13-p12.3 |
Summary | This gene encodes a multi-pass transmembrane protein that belongs to the TMEM134/TMEM230 protein family. The encoded protein localizes to secretory and recycling vesicle in the neuron and may be involved in synaptic vesicles trafficking and recycling. Mutations in this gene may be linked to familial Parkinson's disease. [provided by RefSeq, Mar 2017] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415474 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423152 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423153 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415474 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 3 |
CNY 3080.00 |
|
LY423152 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 2 |
CNY 3080.00 |
|
LY423153 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 4 |
CNY 3080.00 |
|
PH313024 | C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_001009924) |
CNY 19520.00 |
|
PH324414 | C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_001009925) |
CNY 14250.00 |
|
TP301878 | Recombinant protein of human chromosome 20 open reading frame 30 (C20orf30), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP313024 | Recombinant protein of human chromosome 20 open reading frame 30 (C20orf30), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP324414 | Purified recombinant protein of Homo sapiens chromosome 20 open reading frame 30 (C20orf30), transcript variant 4, 20 µg |
CNY 2900.00 |
其它C20orf30产品