14 3 3 gamma (YWHAG) (NM_012479) Human Mass Spec Standard
CAT#: PH301925
YWHAG MS Standard C13 and N15-labeled recombinant protein (NP_036611)
View other "14 3 3 gamma" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | YWHAG MS Standard C13 and N15-labeled recombinant protein (NP_036611) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201925 |
Predicted MW | 28.3 kDa |
Protein Sequence |
>RC201925 protein sequence
Red=Cloning site Green=Tags(s) MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKT SADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATG EKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDT LNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036611 |
RefSeq Size | 3779 |
RefSeq ORF | 741 |
Synonyms | 14-3-3GAMMA; DEE56; EIEE56; PPP1R170 |
Locus ID | 7532 |
Cytogenetics | 7q11.23 |
Summary | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415733 | YWHAG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415733 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide (YWHAG) |
CNY 3080.00 |
|
TP301925 | Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide (YWHAG), 20 µg |
CNY 2900.00 |
其它14 3 3 gamma产品