PPP2R5D (NM_006245) Human Mass Spec Standard
CAT＃: PH301945
PPP2R5D MS Standard C13 and N15-labeled recombinant protein (NP_006236)
View other "PPP2R5D" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PPP2R5D MS Standard C13 and N15-labeled recombinant protein (NP_006236) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201945 |
| Predicted MW | 70 kDa |
| Protein Sequence |
>RC201945 protein sequence
Red=Cloning site Green=Tags(s) MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLS KIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQKLRQCCVLFDFVSDPLSDLK FKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHL QLVYEFFLRFLESPDFQPNIAKKYIDQKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQI NHIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQF LEKESSLTEPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAE RALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKA EKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLK DIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006236 |
| RefSeq Size | 3065 |
| RefSeq ORF | 1806 |
| Synonyms | B56D; B56delta; MRD35 |
| Locus ID | 5528 |
| Cytogenetics | 6p21.1 |
| Summary | The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Phosphatase |
| Protein Pathways | Oocyte meiosis, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405833 | PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405834 | PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC416775 | PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405833 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 2 |
CNY 3080.00 |
|
| LY405834 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 3 |
CNY 4840.00 |
|
| LY416775 | Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 1 |
CNY 3080.00 |
|
| PH300647 | PPP2R5D MS Standard C13 and N15-labeled recombinant protein (NP_851307) |
CNY 19520.00 |
|
| TP300647 | Recombinant protein of human protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP301945 | Purified recombinant protein of Homo sapiens protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP760026 | Recombinant protein of human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它PPP2R5D产品
