POLR2K (NM_005034) Human Mass Spec Standard
CAT#: PH301957
POLR2K MS Standard C13 and N15-labeled recombinant protein (NP_005025)
View other "POLR2K" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | POLR2K MS Standard C13 and N15-labeled recombinant protein (NP_005025) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201957 |
Predicted MW | 7 kDa |
Protein Sequence |
>RC201957 protein sequence
Red=Cloning site Green=Tags(s) MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005025 |
RefSeq Size | 971 |
RefSeq ORF | 174 |
Synonyms | ABC10-alpha; hRPB7.0; hsRPB10a; RPABC4; RPB7.0; RPB10alpha; RPB12 |
Locus ID | 5440 |
Cytogenetics | 8q22.2 |
Summary | This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417596 | POLR2K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417596 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K) |
CNY 3080.00 |
|
TP301957 | Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K), 20 µg |
CNY 2900.00 |