MVK (NM_000431) Human Mass Spec Standard
CAT＃: PH301971
MVK MS Standard C13 and N15-labeled recombinant protein (NP_000422)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | MVK MS Standard C13 and N15-labeled recombinant protein (NP_000422) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201971 |
| Predicted MW | 42.5 kDa |
| Protein Sequence |
>RC201971 protein sequence
Red=Cloning site Green=Tags(s) MLSEVLLVSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLSLPNIGIKRAWDVARLQSL DTSFLEQGDVTTPTSEQVEKLKEVAGLPDDCAVTERLAVLAFLYLYLSICRKQRALPSLDIVVWSELPPG AGLGSSAAYSVCLAAALLTVCEEIPNPLKDGDCVNRWTKEDLELINKWAFQGERMIHGNPSGVDNAVSTW GGALRYHQGKISSLKRSPALQILLTNTKVPRNTRALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLG EMGEAPAPEQYLVLEELIDMNQHHLNALGVGHASLDQLCQVTRARGLHSKLTGAGGGGCGITLLKPGLEQ PEVEATKQALTSCGFDCLETSIGAPGVSIHSATSLDSRVQQALDGL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000422 |
| RefSeq Size | 2084 |
| RefSeq ORF | 1188 |
| Synonyms | LRBP; MK; MVLK; POROK3 |
| Locus ID | 4598 |
| Cytogenetics | 12q24.11 |
| Summary | This gene encodes the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobulinaemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestinal dismay and skin rash. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Terpenoid backbone biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424723 | MVK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426476 | MVK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424723 | Transient overexpression lysate of mevalonate kinase (MVK), transcript variant 1 |
CNY 3080.00 |
|
| LY426476 | Transient overexpression lysate of mevalonate kinase (MVK), transcript variant 2 |
CNY 3080.00 |
|
| PH325616 | MVK MS Standard C13 and N15-labeled recombinant protein (NP_001107657) |
CNY 19520.00 |
|
| TP301971 | Recombinant protein of human mevalonate kinase (MVK), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325616 | Recombinant protein of human mevalonate kinase (MVK), transcript variant 2, 20 µg |
CNY 2900.00 |
